Lineage for d4c2mc2 (4c2m C:76-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3005028Protein RNA polymerases I and III subunit AC40 [346109] (1 species)
  7. 3005029Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346394] (2 PDB entries)
  8. 3005030Domain d4c2mc2: 4c2m C:76-221 [343922]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3hc2
    complexed with so4, zn

Details for d4c2mc2

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (C:) DNA-directed RNA polymerases I and III subunit rpac1

SCOPe Domain Sequences for d4c2mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mc2 d.181.1.1 (C:76-221) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnlpddekftdentivls
lnvkctrnpdapkgstdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillak
lrpgqeislkahcilgiggdhakfsp

SCOPe Domain Coordinates for d4c2mc2:

Click to download the PDB-style file with coordinates for d4c2mc2.
(The format of our PDB-style files is described here.)

Timeline for d4c2mc2: