PDB entry 4c2m

View 4c2m on RCSB PDB site
Description: Structure of RNA polymerase I at 2.8 A resolution
Class: transcription
Keywords: transcription, ribosome biogenesis
Deposited on 2013-08-19, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2m1_
  • Chain '2':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2m2_
  • Chain '3':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2m3_
  • Chain '4':
    Compound: DNA-directed RNA polymerase I subunit rpa43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: DNA-directed RNA polymerase I subunit rpa190
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2ma_
  • Chain 'B':
    Compound: DNA-directed RNA polymerase I subunit rpa135
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mb_
  • Chain 'C':
    Compound: DNA-directed RNA polymerases I and III subunit rpac1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mc1, d4c2mc2
  • Chain 'D':
    Compound: DNA-directed RNA polymerase I subunit rpa14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2me1, d4c2me2
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mf_
  • Chain 'G':
    Compound: DNA-directed RNA polymerase I subunit rpa43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mg1
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mh_
  • Chain 'I':
    Compound: DNA-directed RNA polymerase I subunit rpa12
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mi1, d4c2mi2
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mj_
  • Chain 'K':
    Compound: DNA-directed RNA polymerases I and III subunit rpac2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mk_
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2ml_
  • Chain 'M':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mm_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mn_
  • Chain 'O':
    Compound: DNA-directed RNA polymerase I subunit rpa43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: DNA-directed RNA polymerase I subunit rpa190
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mp_
  • Chain 'Q':
    Compound: DNA-directed RNA polymerase I subunit rpa135
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mq_
  • Chain 'R':
    Compound: DNA-directed RNA polymerases I and III subunit rpac1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mr1, d4c2mr2
  • Chain 'S':
    Compound: DNA-directed RNA polymerase I subunit rpa14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mt1, d4c2mt2
  • Chain 'U':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mu_
  • Chain 'V':
    Compound: DNA-directed RNA polymerase I subunit rpa43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mv1
  • Chain 'W':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mw_
  • Chain 'X':
    Compound: DNA-directed RNA polymerase I subunit rpa12
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mx1, d4c2mx2
  • Chain 'Y':
    Compound: DNA-directed RNA polymerases I, II, and III subunit rpabc 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2my_
  • Chain 'Z':
    Compound: DNA-directed RNA polymerases I and III subunit rpac2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4c2mz_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >4c2m1 (1:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2m1 (1:)
    lkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >4c2m2 (2:)
    msvkrsvseieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerl
    eyegytdsssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiksksdtr
    psalrnalgeafgtkkakkaiadlernridsdkltdsaidivdsvrtaskdlptraqlde
    itsndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnns
    kyvakkldsltqpsqmtklqllyylslllgvyenrrvnnktkllerlnsppeilvdgils
    rftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskv
    vslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfklpemtrrgrgprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2m2 (2:)
    seieiesvqdqpsvavgsffkgfrapsdttfdlykkdefvlhgenerleyegytdsssqa
    snqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiks
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >4c2m3 (3:)
    msklskdyvsdsdsddevisnefsipdgfkkckhlknfplngdnkkkakqqqvwlikfps
    nvdisklkslpvdfessttmtidkhdykimddtdiessltqdnlsnmtllvpseskeslk
    iastakdnaplqfdkvfsvsetakipaidyskvrvprkdvpkveglklehfatgydaedf
    hvaeevkenkkepkkrshhddeeessekkkkkkekrekrekkdkkdkkkkhrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2m3 (3:)
    ipdgfkkckhlknfplnqqqvwlikfpsnvdisklkslpvsttmtidkhdykimddtdie
    ssltqdnlsnmtllvpseskeslkiastakdnaplqfdkvfsvsetakipaidyskvrvp
    rkdvpkveglklehfatgydaedfh
    

  • Chain '4':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4c2mA (A:)
    mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
    lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
    klrllqyglidesykldeitlgslnssmytddeaiednedemdgegskqskdisstllne
    lkskrseyvdmaiakalsdgrttergsftatvnderkklvhefhkkllsrgkcdncgmfs
    pkfrkdgftkifetalnekqitnnrvkgfirqdmikkqkqakkldgsneasandeesfdv
    grnpttrpktgstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvl
    vvpptrfrlpsklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvif
    srlmnafvtiqndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaa
    rsvispdpnietneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqned
    gslvsligmsveqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasm
    mghkvrvlpnektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltp
    tsgspvrgliqdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptif
    kpyplwtgkqiittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgi
    ldksqygaskygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegn
    kwrtdilktsvdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskv
    naitsqvvskcvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvm
    vsgktlpsfkpyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylq
    rcltkqlegvhvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkky
    npsaliehldvesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenf
    qdklesfldknsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqm
    tlntfhfaghgaanvtlgiprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksisk
    vllsevidkvivtettgtsntaggnaarsyvihmrffdnneyseeydvskeelqnvisnq
    fihlleaaivkeikkqkrttgpdigvavprlqtdvansssnskrleedndeeqshkktkq
    avsydepdedeietmreaekssdeegidsdkesdsdsededvdmneqinksiveannnmn
    kvqrdrqsaiishhrfitkynfddesgkwcefklelaadtekllmvniveeicrksiirq
    iphidrcvhpepengkrvlvtegvnfqamwdqeafidvdgitsndvaavlktygveaarn
    tivneinnvfsryaisvsfrhldliadmmtrqgtylafnrqgmetstssfmkmsyettcq
    fltkavldnereqldspsarivvgklnnvgtgsfdvlakvpnaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mA (A:)
    mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
    lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
    klrllqyglidesykldeitlsstllnelkskrseyvdmaiakalsdgrttergsftatv
    nderkklvhefhkkllsrgkcdncgmfspkfrkdgftkifetalnekqitnnrvkgfirq
    dstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvlvvpptrfrlp
    sklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvifsrlmnafvti
    qndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaarsvispdpni
    etneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqnedgslvsligms
    veqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasmmghkvrvlpn
    ektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltptsgspvrgli
    qdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptifkpyplwtgkq
    iittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgildksqygask
    ygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegnkwrtdilkts
    vdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskvnaitsqvvsk
    cvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvmvsgktlpsfk
    pyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylqrcltkqlegv
    hvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkkynpsaliehld
    vesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenfqdklesfldk
    nsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqmtlntfanvtl
    giprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksiskvllsevidkvivtetta
    arsyvihmrffdnneyseeydvskeelqnvisnqfihlleaaivkeikkqkrtpdigvav
    pnskrleedndeeqshkktkqavsydepdedeietmnkvqrdrqsaiishhrfitkynfd
    desgkwcefklelaadtekllmvniveeicrksiirqiphidrcvhpepengkrvlvteg
    vnfqamwdqeafidvdgitsndvaavlktygveaarntivneinnvfsryaisvsfrhld
    liadmmtrqgtylafnrqgmetstssfmkmsyettcqfltkavldnereqldspsarivv
    gklnnvgtgsfdvlakvpnaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4c2mB (B:)
    mskvikppgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggl
    lnlgvkdigekvifdgkplnsedeisnsgylgnklsvsveqvsiakpmsndgvssaverk
    vypsesrqrltsyrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyel
    vqhkeesdeiggyfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvr
    pdqtsqtnvlhylndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkds
    fltdrlelllrgfkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlv
    hlgkdgsqdkfrmllfmirklyslvagecspdnpdatqhqevllggflygmilkekidey
    lqniiaqvrmdinrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqq
    vsgytvvaekinfyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcg
    llnhfahkcristqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheq
    gkiiadtlrywkvegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldk
    edivgpfeqvymniavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcq
    mgkqtmgtpgvalchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytg
    ydmddamiinksadergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekl
    dedglpyigtyveegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqt
    vsikyrirrtpqigdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmti
    gmfveslagkagalhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatge
    elradiyvgvvyyqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdali
    ghgtsfllqdrllnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakk
    lltksedgekifiddsqiwedgqgnkfvggnetttvaipfvlkyldselsamgirlrynv
    epk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mB (B:)
    pgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkd
    igekvifdgkplnsnsgylgnklsvsveqvsiakpmsndgvssaverkvypsesrqrlts
    yrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkeesdeigg
    yfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqtnvlhy
    lndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrlelllrg
    fkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgsqdkfr
    mllfmirklyslvagecspdnpdatqhqevllggflygmilkekideylqniiaqvrmdi
    nrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvvaekin
    fyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfahkcris
    tqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadtlrywk
    vegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpfeqvym
    niavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmgtpgva
    lchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddamiinks
    adergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekldedglpyigtyv
    eegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqtvsikyrirrtpq
    igdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmtigmfveslagkag
    alhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatgeelradiyvgvvy
    yqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdalighgtsfllqdrl
    lnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakklifiddsqiwed
    gqgnkfvggnetttvaipfvlkyldselsamgirlrynvepk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4c2mC (C:)
    msnivgieynrvtnttstdfpgfskdaenewnvekfkkdfevnissldareanfdlinid
    tsianafrrimisevpsvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnl
    pddekftdentivlslnvkctrnpdapkgstdpkelynnahvyardlkfepqgrqsttfa
    dcpvvpadpdillaklrpgqeislkahcilgiggdhakfspvstasyrllpqinilqpik
    gesarrfqkcfppgvigidegsdeayvkdarkdtvsrevlryeefadkvklgrvrnhfif
    nvesagamtpeeiffksvrilknkaeylkncpitq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mC (C:)
    wnvekfkkdfevnissldareanfdlinidtsianafrrimisevpsvaaeyvyffnnts
    viqdevlahriglvplkvdpdmltwvdsnlpddekftdentivlslnvkctrnpdapkgs
    tdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillaklrpgqeislkahcil
    giggdhakfspvstasyrllpqinilqpikgesarrfqkcfppgvigidegsdeayvkda
    rkdtvsrevlryeefadkvklgrvrnhfifnvesagamtpeeiffksvrilknkaeylkn
    cpitq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4c2mE (E:)
    mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
    qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
    mklvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqr
    adpvalylglkrgevvkiirksetsgryasyricm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mE (E:)
    enernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqan
    pteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamkl
    vpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqradp
    valylglkrgevvkiirksetsgryasyricm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4c2mF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mF (F:)
    pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
    tdplriamkelaekkiplvirrylpdgsfedwsveelivd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4c2mG (G:)
    msqvkranenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqg
    vmkqhlnplvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchv
    nlyvwqpqvgdvlegyifiqsashigllihdafnasikknnipvdwtfvhndveedadvi
    ntdenngnnnnednkdsnggsnslgkfsfgnrslghwvdsngepidgklrftvrnvhttg
    rvvsvdgtlisdadeegngynssrsqaeslpivsnkkivfddevsienkeshkeldlpev
    kedngseivyeentsesndgessdsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mG (G:)
    arfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhlnplvmky
    nnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwqpqvgdvl
    egyifiqsashigllihdafnasikknnipvdwtfvhghwvdsngepidgklrftvrnvh
    ttgrvvsvdgtli
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4c2mH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mH (H:)
    ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
    lnswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnlnnl
    kqenayllirr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4c2mI (I:)
    msvvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpssl
    rakksvvktslkknelkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgyk
    frtnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mI (I:)
    svvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpsslr
    akksvvktslkknelkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgykf
    rtnn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4c2mJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4c2mK (K:)
    mtedieqkktatevtpqepkhiqeeeeqdvdmtgdeeqeeepdrekiklltqatsedgts
    asfqiveedhtlgnalryvimknpdvefcgysiphpsenllniriqtygettavdalqkg
    lkdlmdlcdvveskftekiksm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mK (K:)
    pdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsenll
    niriqtygettavdalqkglkdlmdlcdvveskftekiksm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4c2mL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mL (L:)
    lkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4c2mM (M:)
    msvkrsvseieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerl
    eyegytdsssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiksksdtr
    psalrnalgeafgtkkakkaiadlernridsdkltdsaidivdsvrtaskdlptraqlde
    itsndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnns
    kyvakkldsltqpsqmtklqllyylslllgvyenrrvnnktkllerlnsppeilvdgils
    rftvikpgqfgrskdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskv
    vslfrvlgaivkgatvaqaeafgipkstaasykiatmkvpfklpemtrrgrgprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mM (M:)
    seieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerleyegytd
    sssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiks
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4c2mN (N:)
    msklskdyvsdsdsddevisnefsipdgfkkckhlknfplngdnkkkakqqqvwlikfps
    nvdisklkslpvdfessttmtidkhdykimddtdiessltqdnlsnmtllvpseskeslk
    iastakdnaplqfdkvfsvsetakipaidyskvrvprkdvpkveglklehfatgydaedf
    hvaeevkenkkepkkrshhddeeessekkkkkkekrekrekkdkkdkkkkhrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mN (N:)
    sipdgfkkckhlknfplnkqqqvwlikfpsnvdisklkslpvttmtidkhdykimddtdi
    essltqdnlsnmtllvpseskeslkiastakdnaplqfdkvfsvsetakipaidyskvrv
    prkdvpkveglklehfatgydaedf
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4c2mP (P:)
    mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
    lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
    klrllqyglidesykldeitlgslnssmytddeaiednedemdgegskqskdisstllne
    lkskrseyvdmaiakalsdgrttergsftatvnderkklvhefhkkllsrgkcdncgmfs
    pkfrkdgftkifetalnekqitnnrvkgfirqdmikkqkqakkldgsneasandeesfdv
    grnpttrpktgstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvl
    vvpptrfrlpsklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvif
    srlmnafvtiqndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaa
    rsvispdpnietneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqned
    gslvsligmsveqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasm
    mghkvrvlpnektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltp
    tsgspvrgliqdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptif
    kpyplwtgkqiittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgi
    ldksqygaskygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegn
    kwrtdilktsvdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskv
    naitsqvvskcvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvm
    vsgktlpsfkpyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylq
    rcltkqlegvhvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkky
    npsaliehldvesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenf
    qdklesfldknsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqm
    tlntfhfaghgaanvtlgiprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksisk
    vllsevidkvivtettgtsntaggnaarsyvihmrffdnneyseeydvskeelqnvisnq
    fihlleaaivkeikkqkrttgpdigvavprlqtdvansssnskrleedndeeqshkktkq
    avsydepdedeietmreaekssdeegidsdkesdsdsededvdmneqinksiveannnmn
    kvqrdrqsaiishhrfitkynfddesgkwcefklelaadtekllmvniveeicrksiirq
    iphidrcvhpepengkrvlvtegvnfqamwdqeafidvdgitsndvaavlktygveaarn
    tivneinnvfsryaisvsfrhldliadmmtrqgtylafnrqgmetstssfmkmsyettcq
    fltkavldnereqldspsarivvgklnnvgtgsfdvlakvpnaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mP (P:)
    mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
    lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
    klrllqyglidesykldeitlsstllnelkskrseyvdmaiakalsdgrttergsftatv
    nderkklvhefhkkllsrgkcdncgmfspkfrkdgftkifetalnekqitnnrvkgfirq
    dstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvlvvpptrfrlp
    sklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvifsrlmnafvti
    qndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaarsvispdpni
    etneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqnedgslvsligms
    veqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasmmghkvrvlpn
    ektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltptsgspvrgli
    qdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptifkpyplwtgkq
    iittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgildksqygask
    ygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegnkwrtdilkts
    vdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskvnaitsqvvsk
    cvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvmvsgktlpsfk
    pyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylqrcltkqlegv
    hvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkkynpsaliehld
    vesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenfqdklesfldk
    nsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqmtlntfnvtlg
    iprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksiskvllsevidkvivtettaa
    rsyvihmrffdnneyseeydvskeelqnvisnqfihlleaaivkeikkqkdigvavprns
    krleedndeeqshkktkqavsydepdedeietmnkvqrdrqsaiishhrfitkynfddes
    gkwcefklelaadtekllmvniveeicrksiirqiphidrcvhpepengkrvlvtegvnf
    qamwdqeafidvdgitsndvaavlktygveaarntivneinnvfsryaisvsfrhldlia
    dmmtrqgtylafnrqgmetstssfmkmsyettcqfltkavldnereqldspsarivvgkl
    nnvgtgsfdvlakvpnaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4c2mQ (Q:)
    mskvikppgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggl
    lnlgvkdigekvifdgkplnsedeisnsgylgnklsvsveqvsiakpmsndgvssaverk
    vypsesrqrltsyrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyel
    vqhkeesdeiggyfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvr
    pdqtsqtnvlhylndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkds
    fltdrlelllrgfkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlv
    hlgkdgsqdkfrmllfmirklyslvagecspdnpdatqhqevllggflygmilkekidey
    lqniiaqvrmdinrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqq
    vsgytvvaekinfyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcg
    llnhfahkcristqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheq
    gkiiadtlrywkvegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldk
    edivgpfeqvymniavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcq
    mgkqtmgtpgvalchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytg
    ydmddamiinksadergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekl
    dedglpyigtyveegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqt
    vsikyrirrtpqigdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmti
    gmfveslagkagalhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatge
    elradiyvgvvyyqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdali
    ghgtsfllqdrllnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakk
    lltksedgekifiddsqiwedgqgnkfvggnetttvaipfvlkyldselsamgirlrynv
    epk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mQ (Q:)
    pgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkd
    igekvifdgkpylgnklsvsveqvsiakpmsndverkvypsesrqrltsyrgklllklkw
    svnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkeesdeiggyfivngiekli
    rmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqtnvlhylndgqvtfrfs
    wrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrlelllrgfkkryphlqnr
    tqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgsqdkfrmllfmirklys
    lvagecspdnpdatqhqevllggflygmilkekideylqniiaqvrmdinrgmainfkdk
    rymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvvaekinfyrfishfrmv
    hrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfahkcristqqsdvsrips
    ilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadtlrywkvegktpglpid
    leigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpfeqvymniavtpqeiqn
    nvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmgtpgvalchrsdnklyr
    lqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddamiinksadergfgygtm
    yktekvdlalnrnpitqhfgfgndewpkewlekldedglpyigtyveegdpicayfddtl
    nktkiktyhssepayieevnligdeqelqtvsikyrirrtpqigdkfssrhgqkgvcsrk
    wptidmpfsetgiqpdiiinphafpsrmtigmfveslagkagalhgiaqdstpwifnedd
    tpadyfgeqlakagynyhgnepmysgatgeelradiyvgvvyyqrlrhmvndkfqvrstg
    pvnsltmqpvkgrkrhggirvgemerdalighgtsfllqdrllnssdytqasvcrecgsi
    lttqqsvprigsistvccrrcsmrfedakklifiddsqiwedgqgnkfvggnetttvaip
    fvlkyldselsamgirlrynvepk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4c2mR (R:)
    msnivgieynrvtnttstdfpgfskdaenewnvekfkkdfevnissldareanfdlinid
    tsianafrrimisevpsvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnl
    pddekftdentivlslnvkctrnpdapkgstdpkelynnahvyardlkfepqgrqsttfa
    dcpvvpadpdillaklrpgqeislkahcilgiggdhakfspvstasyrllpqinilqpik
    gesarrfqkcfppgvigidegsdeayvkdarkdtvsrevlryeefadkvklgrvrnhfif
    nvesagamtpeeiffksvrilknkaeylkncpitq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mR (R:)
    wnvekfkkdfevnissldareanfdlinidtsianafrrimisevpsvaaeyvyffnnts
    viqdevlahriglvplkvdpdmltwvdsnlpddekftdentivlslnvkctrnpdapkgs
    tdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillaklrpgqeislkahcil
    giggdhakfspvstasyrllpqinilqpikgesarrfqkcfppgvigidegsdeayvkda
    rkdtvsrevlryeefadkvklgrvrnhfifnvesagamtpeeiffksvrilknkaeylkn
    cpitq
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4c2mT (T:)
    mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
    qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
    mklvpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqr
    adpvalylglkrgevvkiirksetsgryasyricm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mT (T:)
    enernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqan
    pteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamkl
    vpsippatietfneaalvvnithhelvpkhirlssdekrellkryrlkesqlpriqradp
    valylglkrgevvkiirksetsgryasyricm
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4c2mU (U:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mU (U:)
    pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
    tdplriamkelaekkiplvirrylpdgsfedwsveelivd
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4c2mV (V:)
    msqvkranenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqg
    vmkqhlnplvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchv
    nlyvwqpqvgdvlegyifiqsashigllihdafnasikknnipvdwtfvhndveedadvi
    ntdenngnnnnednkdsnggsnslgkfsfgnrslghwvdsngepidgklrftvrnvhttg
    rvvsvdgtlisdadeegngynssrsqaeslpivsnkkivfddevsienkeshkeldlpev
    kedngseivyeentsesndgessdsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mV (V:)
    arfikkhkkqvtnpidngtsncivrvpialyvslapmylenplqgvmkqhlnplvmkynn
    kvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwqpqvgdvleg
    yifiqsashigllihdafnasikknnipvdwtfvhndveedghwvdsngepidgklrftv
    rnvhttgrvvsvdgtli
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4c2mW (W:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mW (W:)
    ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
    lnswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnlnnl
    kqenayllirr
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4c2mX (X:)
    msvvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpssl
    rakksvvktslkknelkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgyk
    frtnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mX (X:)
    svvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpsslr
    akksvvktslkdgatikekcpqcgneemnyhtlqlrsadegatvfytctscgykfrtnn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4c2mY (Y:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mY (Y:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekr
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4c2mZ (Z:)
    mtedieqkktatevtpqepkhiqeeeeqdvdmtgdeeqeeepdrekiklltqatsedgts
    asfqiveedhtlgnalryvimknpdvefcgysiphpsenllniriqtygettavdalqkg
    lkdlmdlcdvveskftekiksm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c2mZ (Z:)
    drekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsenlln
    iriqtygettavdalqkglkdlmdlcdvveskftekiksm