SCOPe 2.08: Domain d4c2mz_: 4c2m Z:

Lineage for d4c2mz_ (4c2m Z:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.0: automated matches [254324] (1 protein)
   not a true family

6. Protein automated matches [254742] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256218] (2 PDB entries)

8. Domain d4c2mz_: 4c2m Z: [240046]
   Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_
   automated match to d1twfk_
   complexed with so4, zn

Details for d4c2mz_

PDB Entry: 4c2m, 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution

PDB Compounds: (Z:) DNA-directed RNA polymerases I and III subunit rpac2

SCOPe Domain Sequences for d4c2mz_:

Sequence; same for both SEQRES and ATOM records:

>d4c2mz_ d.74.3.0 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsenlln
iriqtygettavdalqkglkdlmdlcdvveskftekiksm

Timeline for d4c2mz_:

• d4c2mz_ first appeared in SCOPe 2.04
  
• d4c2mz_ appears in SCOPe 2.07