| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (2 proteins) |
| Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
| Domain d4c2mf_: 4c2m F: [228425] Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_ automated match to d2nvqf_ complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
tdplriamkelaekkiplvirrylpdgsfedwsveelivd
Timeline for d4c2mf_:
View in 3DDomains from other chains: (mouse over for more information) d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_ |