Lineage for d4c2mc1 (4c2m C:31-75,C:222-335)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958224Protein RNA polymerases I and III subunit AC40 [346099] (1 species)
  7. 2958225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346366] (2 PDB entries)
  8. 2958226Domain d4c2mc1: 4c2m C:31-75,C:222-335 [343921]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3hc1
    complexed with so4, zn

Details for d4c2mc1

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (C:) DNA-directed RNA polymerases I and III subunit rpac1

SCOPe Domain Sequences for d4c2mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mc1 d.74.3.1 (C:31-75,C:222-335) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wnvekfkkdfevnissldareanfdlinidtsianafrrimisevXvstasyrllpqini
lqpikgesarrfqkcfppgvigidegsdeayvkdarkdtvsrevlryeefadkvklgrvr
nhfifnvesagamtpeeiffksvrilknkaeylkncpitq

SCOPe Domain Coordinates for d4c2mc1:

Click to download the PDB-style file with coordinates for d4c2mc1.
(The format of our PDB-style files is described here.)

Timeline for d4c2mc1: