Lineage for d4c2mw_ (4c2m W:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790275Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2790276Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2790277Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
    Uniprot P20436
  8. 2790286Domain d4c2mw_: 4c2m W: [228432]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d1twfh_
    complexed with so4, zn

Details for d4c2mw_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (W:) DNA-directed RNA polymerases I, II, and III subunit rpabc 3

SCOPe Domain Sequences for d4c2mw_:

Sequence, based on SEQRES records: (download)

>d4c2mw_ b.40.4.8 (W:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggll
mrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d4c2mw_ b.40.4.8 (W:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnlnnl
kqenayllirr

SCOPe Domain Coordinates for d4c2mw_:

Click to download the PDB-style file with coordinates for d4c2mw_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mw_: