Lineage for d4c2mp_ (4c2m P:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574376Protein RNA polymerase I subunit A190 [346118] (1 species)
  7. 2574377Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346415] (2 PDB entries)
  8. 2574379Domain d4c2mp_: 4c2m P: [343928]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3ha_
    complexed with so4, zn

Details for d4c2mp_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (P:) DNA-directed RNA polymerase I subunit rpa190

SCOPe Domain Sequences for d4c2mp_:

Sequence, based on SEQRES records: (download)

>d4c2mp_ e.29.1.2 (P:) RNA polymerase I subunit A190 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
klrllqyglidesykldeitlgslnssmytddeaiednedemdgegskqskdisstllne
lkskrseyvdmaiakalsdgrttergsftatvnderkklvhefhkkllsrgkcdncgmfs
pkfrkdgftkifetalnekqitnnrvkgfirqdmikkqkqakkldgsneasandeesfdv
grnpttrpktgstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvl
vvpptrfrlpsklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvif
srlmnafvtiqndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaa
rsvispdpnietneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqned
gslvsligmsveqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasm
mghkvrvlpnektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltp
tsgspvrgliqdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptif
kpyplwtgkqiittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgi
ldksqygaskygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegn
kwrtdilktsvdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskv
naitsqvvskcvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvm
vsgktlpsfkpyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylq
rcltkqlegvhvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkky
npsaliehldvesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenf
qdklesfldknsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqm
tlntfhfaghgaanvtlgiprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksisk
vllsevidkvivtettgtsntaggnaarsyvihmrffdnneyseeydvskeelqnvisnq
fihlleaaivkeikkqkrttgpdigvavprlqtdvansssnskrleedndeeqshkktkq
avsydepdedeietmreaekssdeegidsdkesdsdsededvdmneqinksiveannnmn
kvqrdrqsaiishhrfitkynfddesgkwcefklelaadtekllmvniveeicrksiirq
iphidrcvhpepengkrvlvtegvnfqamwdqeafidvdgitsndvaavlktygveaarn
tivneinnvfsryaisvsfrhldliadmmtrqgtylafnrqgmetstssfmkmsyettcq
fltkavldnereqldspsarivvgklnnvgtgsfdvlakvpnaa

Sequence, based on observed residues (ATOM records): (download)

>d4c2mp_ e.29.1.2 (P:) RNA polymerase I subunit A190 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiskpvgseitsvdfgiltakeirnlsakqitnptvldnlghpvsgglydlalgaflrn
lcstcgldekfcpghqghielpvpcynplffnqlyiylrasclfchhfrlksvevhryac
klrllqyglidesykldeitlsstllnelkskrseyvdmaiakalsdgrttergsftatv
nderkklvhefhkkllsrgkcdncgmfspkfrkdgftkifetalnekqitnnrvkgfirq
dstyilstevknildtvfrkeqcvlqyvfhsrpnlsrklvkadsffmdvlvvpptrfrlp
sklgeevhensqnqllskvlttsllirdlnddlsklqkdkvsledrrvifsrlmnafvti
qndvnafidstkaqgrtsgkvpipgvkqalekkeglfrkhmmgkrvnyaarsvispdpni
etneigvppvfavkltypepvtayniaelrqavingpdkwpgatqiqnedgslvsligms
veqrkalanqlltpssnvsthtlnkkvyrhiknrdvvlmnrqptlhkasmmghkvrvlpn
ektlrlhyantgaynadfdgdemnmhfpqnenaraealnlantdsqyltptsgspvrgli
qdhisagvwltskdsfftreqyqqyiygcirpedghttrskivtlpptifkpyplwtgkq
iittvllnvtppdmpginlisknkikneywgkgslenevlfkdgallcgildksqygask
ygivhslhevygpevaakvlsvlgrlftnyitataftcgmddlrltaegnkwrtdilkts
vdtgreaaaevtnldkdtpaddpellkrlqeilrdnnksgildavtsskvnaitsqvvsk
cvpdgtmkkfpcnsmqamalsgakgsnvnvsqimcllgqqalegrrvpvmvsgktlpsfk
pyetdamaggyvkgrfysgikpqeyyfhcmagreglidtavktsrsgylqrcltkqlegv
hvsydnsirdadgtlvqfmyggdaiditkeshmtqfefcldnyyallkkynpsaliehld
vesalkyskktlkyrkkhskephykqsvkydpvlakynpakylgsvsenfqdklesfldk
nsklfkssdgvnekkfralmqlkymrslinpgeavgiiasqsvgepstqmtlntfnvtlg
iprlreivmtasaaiktpqmtlpiwndvsdeqadtfcksiskvllsevidkvivtettaa
rsyvihmrffdnneyseeydvskeelqnvisnqfihlleaaivkeikkqkdigvavprns
krleedndeeqshkktkqavsydepdedeietmnkvqrdrqsaiishhrfitkynfddes
gkwcefklelaadtekllmvniveeicrksiirqiphidrcvhpepengkrvlvtegvnf
qamwdqeafidvdgitsndvaavlktygveaarntivneinnvfsryaisvsfrhldlia
dmmtrqgtylafnrqgmetstssfmkmsyettcqfltkavldnereqldspsarivvgkl
nnvgtgsfdvlakvpnaa

SCOPe Domain Coordinates for d4c2mp_:

Click to download the PDB-style file with coordinates for d4c2mp_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mp_:

  • d4c2mp_ is new in SCOPe 2.07-stable