SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4c2mh_ (4c2m H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052082Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2052083Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2052084Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 2052095Domain d4c2mh_: 4c2m H: [228427]
    Other proteins in same PDB: d4c2m1_, d4c2me1, d4c2me2, d4c2mf_, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mt1, d4c2mt2, d4c2mu_, d4c2my_, d4c2mz_
    automated match to d1twfh_
    complexed with so4, zn

Details for d4c2mh_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit rpabc 3

SCOPe Domain Sequences for d4c2mh_:

Sequence, based on SEQRES records: (download)

>d4c2mh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggll
mrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d4c2mh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnlnnl
kqenayllirr

SCOPe Domain Coordinates for d4c2mh_:

Click to download the PDB-style file with coordinates for d4c2mh_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mh_: