Lineage for d1fjfr_ (1fjf R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1724Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1725Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1726Protein Ribosomal protein S18 [46913] (1 species)
  7. 1727Species Thermus thermophilus [TaxId:274] [46914] (7 PDB entries)
  8. 1730Domain d1fjfr_: 1fjf R: [16251]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfr_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1fjfr_:

Click to download the PDB-style file with coordinates for d1fjfr_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfr_: