Lineage for d1fjfi_ (1fjf I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30320Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 30321Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 30322Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 30340Protein Ribosomal protein S9 [54218] (1 species)
  7. 30341Species Thermus thermophilus [TaxId:274] [54219] (6 PDB entries)
  8. 30342Domain d1fjfi_: 1fjf I: [37558]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfi_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1fjfi_:

Click to download the PDB-style file with coordinates for d1fjfi_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfi_: