Lineage for d1fjfk_ (1fjf K:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25432Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 25433Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 25437Protein Ribosomal protein S11 [53141] (1 species)
  7. 25438Species Thermus thermophilus [TaxId:274] [53142] (6 PDB entries)
  8. 25439Domain d1fjfk_: 1fjf K: [33732]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfk_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1fjfk_:

Click to download the PDB-style file with coordinates for d1fjfk_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfk_: