Lineage for d1fjfk_ (1fjf K:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.4: Translational machinery components [53137] (2 families) 
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) 
Protein Ribosomal protein S11 [53141] (1 species) Species Thermus thermophilus [TaxId:274] [53142] (6 PDB entries) 
Domain d1fjfk_: 1fjf K: [33732]
Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_
Details for d1fjfk_
PDB Entry: 1fjf (more details), 3.05 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit
SCOP Domain Sequences for d1fjfk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
SCOP Domain Coordinates for d1fjfk_:
Click to download the PDB-style file with coordinates for d1fjfk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fjfk_:
- d1fjfk_ appears in SCOP 1.57
- d1fjfk_ last appears in SCOP 1.59
View in 3D
