Lineage for d1fjfc2 (1fjf C:107-207)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) 
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) Protein Ribosomal protein S3 C-terminal domain [54823] (1 species) Species Thermus thermophilus [TaxId:274] [54824] (6 PDB entries) 
Domain d1fjfc2: 1fjf C:107-207 [38838]
Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_
Details for d1fjfc2
PDB Entry: 1fjf (more details), 3.05 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit
SCOP Domain Sequences for d1fjfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev
SCOP Domain Coordinates for d1fjfc2:
Click to download the PDB-style file with coordinates for d1fjfc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fjfc2:
- d1fjfc2 appears in SCOP 1.57
- d1fjfc2 last appears in SCOP 1.59
View in 3D
