Lineage for d1fjfs_ (1fjf S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31583Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
  4. 31584Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 31585Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 31586Protein Ribosomal protein S19 [54572] (1 species)
  7. 31587Species Thermus thermophilus [TaxId:274] [54573] (8 PDB entries)
  8. 31588Domain d1fjfs_: 1fjf S: [38450]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjft_, d1fjfv_

Details for d1fjfs_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1fjfs_:

Click to download the PDB-style file with coordinates for d1fjfs_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfs_: