Lineage for d1fjfh_ (1fjf H:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36073Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
  4. 36074Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 36075Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 36076Protein Ribosomal protein S8 [56049] (2 species)
  7. 36080Species Thermus thermophilus [TaxId:274] [56051] (7 PDB entries)
  8. 36083Domain d1fjfh_: 1fjf H: [41467]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfh_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1fjfh_:

Click to download the PDB-style file with coordinates for d1fjfh_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfh_: