Lineage for d1fjfc1 (1fjf C:2-106)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32181Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 32208Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) (S)
  5. 32209Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)
  6. 32214Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 32215Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries)
  8. 32216Domain d1fjfc1: 1fjf C:2-106 [38830]
    Other proteins in same PDB: d1fjfb_, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfc1

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1fjfc1:

Click to download the PDB-style file with coordinates for d1fjfc1.
(The format of our PDB-style files is described here.)

Timeline for d1fjfc1: