Lineage for d1fjfd_ (1fjf D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33288Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 33289Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 33294Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 33295Protein Ribosomal protein S4 [55179] (2 species)
  7. 33299Species Thermus thermophilus [TaxId:274] [55180] (6 PDB entries)
  8. 33300Domain d1fjfd_: 1fjf D: [39552]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfd_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOP Domain Coordinates for d1fjfd_:

Click to download the PDB-style file with coordinates for d1fjfd_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfd_: