Lineage for d1fjfm_ (1fjf M:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1802Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 1803Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 1804Protein Ribosomal protein S13 [46948] (1 species)
  7. 1805Species Thermus thermophilus [TaxId:274] [46949] (6 PDB entries)
  8. 1806Domain d1fjfm_: 1fjf M: [16292]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfm_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1fjfm_:

Click to download the PDB-style file with coordinates for d1fjfm_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfm_: