Lineage for d1fjff_ (1fjf F:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32873Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 32874Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 32875Protein Ribosomal protein S6 [54997] (1 species)
  7. 32876Species Thermus thermophilus [TaxId:274] [54998] (12 PDB entries)
  8. 32886Domain d1fjff_: 1fjf F: [39315]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjff_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjff_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1fjff_:

Click to download the PDB-style file with coordinates for d1fjff_.
(The format of our PDB-style files is described here.)

Timeline for d1fjff_: