Lineage for d1fjfg_ (1fjf G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4927Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
  4. 4928Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 4929Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 4930Protein Ribosomal protein S7 [47975] (2 species)
  7. 4933Species Thermus thermophilus [TaxId:274] [47977] (7 PDB entries)
  8. 4935Domain d1fjfg_: 1fjf G: [18393]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfg_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1fjfg_:

Click to download the PDB-style file with coordinates for d1fjfg_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfg_: