Lineage for d2erjh_ (2erj H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705612Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 2705613Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries)
  8. 2705640Domain d2erjh_: 2erj H: [132301]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjc1, d2erjc2, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjg1, d2erjg2
    automated match to d1irla_
    complexed with nag

Details for d2erjh_

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (H:) interleukin-2

SCOPe Domain Sequences for d2erjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjh_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
tssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleee
lkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwi
tfaqsiistlt

SCOPe Domain Coordinates for d2erjh_:

Click to download the PDB-style file with coordinates for d2erjh_.
(The format of our PDB-style files is described here.)

Timeline for d2erjh_: