Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-2 (IL-2) [47301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47302] (19 PDB entries) |
Domain d2erjh_: 2erj H: [132301] Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjc1, d2erjc2, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjg1, d2erjg2 automated match to d1irla_ complexed with nag |
PDB Entry: 2erj (more details), 3 Å
SCOPe Domain Sequences for d2erjh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erjh_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} tssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleee lkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwi tfaqsiistlt
Timeline for d2erjh_: