PDB entry 2erj

View 2erj on RCSB PDB site
Description: Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
Class: immune system/cytokine
Keywords: interleukin-2, interleukin-2 alpha receptor, interleukin-2 beta receptor, interleukin-2 gamma receptor, immune system-cytokine complex
Deposited on 2005-10-25, released 2006-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-2 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01589 (5-End)
      • engineered (53)
    Domains in SCOPe 2.06: d2erja1, d2erja2
  • Chain 'B':
    Compound: Interleukin-2 receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14784 (Start-210)
      • expression tag (211-213)
    Domains in SCOPe 2.06: d2erjb1, d2erjb2, d2erjb3
  • Chain 'C':
    Compound: Cytokine receptor common gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31785
      • engineered (57)
    Domains in SCOPe 2.06: d2erjc1, d2erjc2
  • Chain 'D':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (Start-132)
      • engineered (124)
    Domains in SCOPe 2.06: d2erjd_
  • Chain 'E':
    Compound: Interleukin-2 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01589 (5-End)
      • engineered (53)
    Domains in SCOPe 2.06: d2erje1, d2erje2
  • Chain 'F':
    Compound: Interleukin-2 receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14784 (Start-210)
      • expression tag (211-213)
    Domains in SCOPe 2.06: d2erjf1, d2erjf2, d2erjf3
  • Chain 'G':
    Compound: Cytokine receptor common gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31785
      • engineered (57)
    Domains in SCOPe 2.06: d2erjg1, d2erjg2
  • Chain 'H':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (Start-132)
      • engineered (124)
    Domains in SCOPe 2.06: d2erjh_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2erjA (A:)
    gmlslelcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshssw
    dnqcqctssatrsttkqvtpqpeeqkerkttemqspmqpvdqaslpghcrepppweneat
    eriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqlictgemetsqfpge
    ekpqaspegrpesetsclvtttdfqiqtemaatmetstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjA (A:)
    elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshsswdnqcq
    ctsslpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktr
    wtqpqlictg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2erjB (B:)
    gmlslavngtsqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsq
    aswacnlilgapdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvv
    hvethrcnisweisqashyferhlefeartlspghtweeaplltlkqkqewicletltpd
    tqyefqvrvkplqgefttwspwsqplafrtktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjB (B:)
    sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
    apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhvethrcnis
    weisqashyferhlefeartlspghtweeaplltlkqkqewicletltpdtqyefqvrvk
    plqgefttwspwsqplafrtktgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2erjC (C:)
    gmlsllnttiltpngnedttadfflttmptdslsvstlplpevqcfvfnveymnctwqss
    sepqptnltlhywyknsdndkvqkcshylfseeitsgcqlqkkeihlyqtfvvqlqdpre
    prrqatqmlklqnlvipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhsw
    teqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgsaqhwsewshpihwgsntskenprt
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjC (C:)
    tlplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeits
    gcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenltlhklsesqleln
    wnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgs
    aqhwsewshpihwgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2erjD (D:)
    aptssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcle
    eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
    witfaqsiistlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjD (D:)
    tssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleee
    lkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwi
    tfaqsiistlt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2erjE (E:)
    gmlslelcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshssw
    dnqcqctssatrsttkqvtpqpeeqkerkttemqspmqpvdqaslpghcrepppweneat
    eriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqlictgemetsqfpge
    ekpqaspegrpesetsclvtttdfqiqtemaatmetstghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjE (E:)
    elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshsswdnqcq
    ctssalpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgkt
    rwtqpqlictg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2erjF (F:)
    gmlslavngtsqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsq
    aswacnlilgapdsqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvv
    hvethrcnisweisqashyferhlefeartlspghtweeaplltlkqkqewicletltpd
    tqyefqvrvkplqgefttwspwsqplafrtktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjF (F:)
    sqftcfynsraniscvwsqdgdtscqvhawpdrrrwnqtcellpvsqaswacnlilgapd
    sqklttvdivtlrvlcregvrwrvmaiqdfkpfenlrlmapislqvvhvethrcniswei
    sqashyferhlefeartlspghtweeaplltlkqkqewicletltpdtqyefqvrvkplq
    gefttwspwsqplafrtktgh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2erjG (G:)
    gmlsllnttiltpngnedttadfflttmptdslsvstlplpevqcfvfnveymnctwqss
    sepqptnltlhywyknsdndkvqkcshylfseeitsgcqlqkkeihlyqtfvvqlqdpre
    prrqatqmlklqnlvipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhsw
    teqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgsaqhwsewshpihwgsntskenprt
    ghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjG (G:)
    tlplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeits
    gcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnlvipwapenltlhklsesqleln
    wnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslpsvdgqkrytfrvrsrfnplcgs
    aqhwsewshpihwgs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2erjH (H:)
    aptssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcle
    eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
    witfaqsiistlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erjH (H:)
    tssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleee
    lkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwi
    tfaqsiistlt