Lineage for d2erjb2 (2erj B:6-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762018Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2762019Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2762027Domain d2erjb2: 2erj B:6-103 [132291]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erje1, d2erje2, d2erjf3, d2erjg1, d2erjg2, d2erjh_
    complexed with nag

Details for d2erjb2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOPe Domain Sequences for d2erjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjb2 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOPe Domain Coordinates for d2erjb2:

Click to download the PDB-style file with coordinates for d2erjb2.
(The format of our PDB-style files is described here.)

Timeline for d2erjb2: