Lineage for d1irla_ (1irl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705612Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 2705613Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries)
  8. 2705659Domain d1irla_: 1irl A: [16883]
    mutant

Details for d1irla_

PDB Entry: 1irl (more details)

PDB Description: the solution structure of the f42a mutant of human interleukin 2
PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d1irla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irla_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

SCOPe Domain Coordinates for d1irla_:

Click to download the PDB-style file with coordinates for d1irla_.
(The format of our PDB-style files is described here.)

Timeline for d1irla_: