Lineage for d2erje2 (2erj E:1-64)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034273Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 3034274Species Human (Homo sapiens) [TaxId:9606] [144118] (5 PDB entries)
    Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85
  8. 3034288Domain d2erje2: 2erj E:1-64 [132296]
    Other proteins in same PDB: d2erjb1, d2erjb2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erjf1, d2erjf2, d2erjf3, d2erjg1, d2erjg2, d2erjh_
    automated match to d2erja2
    complexed with nag

Details for d2erje2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (E:) Interleukin-2 receptor alpha chain

SCOPe Domain Sequences for d2erje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erje2 g.18.1.1 (E:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgssshsswdnqcq
ctss

SCOPe Domain Coordinates for d2erje2:

Click to download the PDB-style file with coordinates for d2erje2.
(The format of our PDB-style files is described here.)

Timeline for d2erje2: