SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2erjf1 (2erj F:104-206)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029703Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2029704Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2029711Domain d2erjf1: 2erj F:104-206 [132297]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erje1, d2erje2, d2erjf3, d2erjg1, d2erjg2, d2erjh_
    automated match to d2erjb1
    complexed with nag

Details for d2erjf1

PDB Entry: 2erj (more details), 3 Å

PDB Description: Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (F:) Interleukin-2 receptor beta chain

SCOPe Domain Sequences for d2erjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjf1 b.1.2.1 (F:104-206) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtk

SCOPe Domain Coordinates for d2erjf1:

Click to download the PDB-style file with coordinates for d2erjf1.
(The format of our PDB-style files is described here.)

Timeline for d2erjf1: