![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Interleukin-2 receptor beta chain [141047] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
![]() | Domain d2erjf1: 2erj F:104-206 [132297] Other proteins in same PDB: d2erja1, d2erja2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erje1, d2erje2, d2erjf3, d2erjg1, d2erjg2, d2erjh_ automated match to d2erjb1 complexed with nag |
PDB Entry: 2erj (more details), 3 Å
SCOPe Domain Sequences for d2erjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erjf1 b.1.2.1 (F:104-206) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtk
Timeline for d2erjf1: