SCOP 1.73: Domain d2erjf1: 2erj F:104-206

Lineage for d2erjf1 (2erj F:104-206)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Interleukin-2 receptor beta chain [141047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries)

8. Domain d2erjf1: 2erj F:104-206 [132297]
   Other proteins in same PDB: d2erja1, d2erja2, d2erjc1, d2erjc2, d2erjd1, d2erje1, d2erje2, d2erjg1, d2erjg2, d2erjh1
   automatically matched to 2ERJ B:104-206
   complexed with bma, fuc, nag; mutant

Details for d2erjf1

PDB Entry: 2erj, 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2

PDB Compounds: (F:) Interleukin-2 receptor beta chain

SCOP Domain Sequences for d2erjf1:

Sequence; same for both SEQRES and ATOM records:

>d2erjf1 b.1.2.1 (F:104-206) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtk

Timeline for d2erjf1:

• d2erjf1 is new in SCOP 1.73
  
• d2erjf1 appears in SCOP 1.75
  
• d2erjf1 appears in the current release, SCOPe 2.08