Lineage for d2erjg2 (2erj G:130-226)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. Domain d2erjg2: 2erj G:130-226 [132300]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjd_, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjh_
    automated match to d2erjc2
    complexed with nag

Details for d2erjg2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (G:) Cytokine receptor common gamma chain

SCOPe Domain Sequences for d2erjg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjg2 b.1.2.1 (G:130-226) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihwgs

SCOPe Domain Coordinates for d2erjg2 are not available.

Timeline for d2erjg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2erjg1
View in 3D
Domains from other chains:
(mouse over for more information)
d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjh_