SCOPe 2.07: Domain d2erjg2: 2erj G:130-226

Lineage for d2erjg2 (2erj G:130-226)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor common gamma chain [141041] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
   Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141

8. Domain d2erjg2: 2erj G:130-226 [132300]
   Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjd_, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjh_
   automated match to d2erjc2
   complexed with nag

Details for d2erjg2

PDB Entry: 2erj, 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2

PDB Compounds: (G:) Cytokine receptor common gamma chain

SCOPe Domain Sequences for d2erjg2:

Sequence; same for both SEQRES and ATOM records:

>d2erjg2 b.1.2.1 (G:130-226) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihwgs

Timeline for d2erjg2:

• d2erjg2 first appeared in SCOP 1.73
  
• d2erjg2 appears in SCOPe 2.06
  
• d2erjg2 appears in the current release, SCOPe 2.08