Lineage for d2erjh1 (2erj H:6-133)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 639437Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 639507Family a.26.1.2: Short-chain cytokines [47286] (11 proteins)
  6. 639530Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 639531Species Human (Homo sapiens) [TaxId:9606] [47302] (14 PDB entries)
  8. 639548Domain d2erjh1: 2erj H:6-133 [132301]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjg1, d2erjg2
    automatically matched to d3inkc_
    complexed with bma, fuc, nag; mutant

Details for d2erjh1

PDB Entry: 2erj (more details), 3 Å

PDB Description: Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (H:) interleukin-2

SCOP Domain Sequences for d2erjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjh1 a.26.1.2 (H:6-133) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfa
qsiistlt

SCOP Domain Coordinates for d2erjh1:

Click to download the PDB-style file with coordinates for d2erjh1.
(The format of our PDB-style files is described here.)

Timeline for d2erjh1: