Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.30: Photosystem I reaction center subunit X, PsaK [81564] (1 superfamily) core: hairpin of two transmembrane helices |
Superfamily f.30.1: Photosystem I reaction center subunit X, PsaK [81563] (2 families) automatically mapped to Pfam PF01241 |
Family f.30.1.0: automated matches [347302] (1 protein) not a true family |
Protein automated matches [347303] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [420063] (1 PDB entry) |
Domain d6trd9_: 6trd 9: [411857] Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_ automated match to d5oy08_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trd9_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trd9_ f.30.1.0 (9:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tlpdttwtpsvglvvilcnlfaialgryaiqsrgkgpglpialpalfegfglpellatts fghllaagvvsglqyagal
Timeline for d6trd9_: