Lineage for d6trd9_ (6trd 9:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027916Fold f.30: Photosystem I reaction center subunit X, PsaK [81564] (1 superfamily)
    core: hairpin of two transmembrane helices
  4. 3027917Superfamily f.30.1: Photosystem I reaction center subunit X, PsaK [81563] (2 families) (S)
    automatically mapped to Pfam PF01241
  5. 3027922Family f.30.1.0: automated matches [347302] (1 protein)
    not a true family
  6. 3027923Protein automated matches [347303] (2 species)
    not a true protein
  7. 3027929Species Thermosynechococcus elongatus [TaxId:197221] [420063] (1 PDB entry)
  8. 3027930Domain d6trd9_: 6trd 9: [411857]
    Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
    automated match to d5oy08_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd9_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (9:) Photosystem I reaction center subunit PsaK

SCOPe Domain Sequences for d6trd9_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trd9_ f.30.1.0 (9:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tlpdttwtpsvglvvilcnlfaialgryaiqsrgkgpglpialpalfegfglpellatts
fghllaagvvsglqyagal

SCOPe Domain Coordinates for d6trd9_:

Click to download the PDB-style file with coordinates for d6trd9_.
(The format of our PDB-style files is described here.)

Timeline for d6trd9_:

  • d6trd9_ is new in SCOPe 2.08-stable