Lineage for d6trd0_ (6trd 0:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027934Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins)
  6. 3027938Protein automated matches [347525] (2 species)
    not a true protein
  7. 3027944Species Thermosynechococcus elongatus [TaxId:197221] [377769] (5 PDB entries)
  8. 3027948Domain d6trd0_: 6trd 0: [392119]
    Other proteins in same PDB: d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
    automated match to d1jb0l_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd0_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (0:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6trd0_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trd0_ f.31.1.1 (0:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw
vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta
gffvgamgsafvaffllenflvvdgimtglfn

SCOPe Domain Coordinates for d6trd0_:

Click to download the PDB-style file with coordinates for d6trd0_.
(The format of our PDB-style files is described here.)

Timeline for d6trd0_: