SCOPe 2.08: Domain d6trdm_: 6trd M:

Lineage for d6trdm_ (6trd M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family)
   automatically mapped to Pfam PF07465

5. Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)

6. Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377772] (5 PDB entries)

8. Domain d6trdm_: 6trd M: [392040]
   Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdl_, d6trdx_, d6trdz_
   automated match to d1jb0m_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdm_

PDB Entry: 6trd, 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (M:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6trdm_:

Sequence; same for both SEQRES and ATOM records:

>d6trdm_ f.23.19.1 (M:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]}
maltdtqvyvalviallpavlafrlstelyk

Timeline for d6trdm_:

• d6trdm_ first appeared in SCOPe 2.07