Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein Photosystem I iron-sulfur protein PsaC [64272] (4 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [377867] (4 PDB entries) |
Domain d6trdc_: 6trd c: [392049] Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_ automated match to d1jb0c_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trdc_ d.58.1.2 (c:) Photosystem I iron-sulfur protein PsaC {Thermosynechococcus elongatus [TaxId: 197221]} ahtvkiydtcigctqcvracptdvlemvpwdgckagqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d6trdc_: