![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
![]() | Protein automated matches [347525] (2 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377769] (5 PDB entries) |
![]() | Domain d6trdl_: 6trd l: [392106] Other proteins in same PDB: d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdm_, d6trdx_, d6trdy_, d6trdz_ automated match to d1jb0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trdl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trdl_ f.31.1.1 (l:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} elvkpyngdpfvghlstpisdsglvktfignlpayrqglspilrglevgmahgyfligpw vklgplrdsdvanlgglisgialilvataclaayglvsfqkggsssdplktsegwsqfta gffvgamgsafvaffllenflvvdgimtglfn
Timeline for d6trdl_: