SCOPe 2.08: Domain d6trdd_: 6trd d:

Lineage for d6trdd_ (6trd d:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
   beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail

4. Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family)
   automatically mapped to Pfam PF02531

5. Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)

6. Protein Photosystem I subunit PsaD [64236] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377957] (5 PDB entries)

8. Domain d6trdd_: 6trd d: [392051]
   Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
   automated match to d1jb0d_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdd_

PDB Entry: 6trd, 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (d:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6trdd_:

Sequence; same for both SEQRES and ATOM records:

>d6trdd_ d.187.1.1 (d:) Photosystem I subunit PsaD {Thermosynechococcus elongatus [TaxId: 197221]}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

Timeline for d6trdd_:

• d6trdd_ first appeared in SCOPe 2.07