SCOPe 2.08: Domain d6trdi_: 6trd i:

Lineage for d6trdi_ (6trd i:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family)

5. Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)

6. Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [377780] (5 PDB entries)

8. Domain d6trdi_: 6trd i: [392035]
   Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
   automated match to d1jb0i_
   complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trdi_

PDB Entry: 6trd, 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6

PDB Compounds: (i:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6trdi_:

Sequence; same for both SEQRES and ATOM records:

>d6trdi_ f.23.17.1 (i:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

Timeline for d6trdi_:

• d6trdi_ first appeared in SCOPe 2.07