Lineage for d6trd4_ (6trd 4:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005550Protein Photosystem I subunit PsaD [64236] (2 species)
  7. 3005553Species Thermosynechococcus elongatus [TaxId:197221] [377957] (5 PDB entries)
  8. 3005557Domain d6trd4_: 6trd 4: [392042]
    Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
    automated match to d1jb0d_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd4_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (4:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6trd4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trd4_ d.187.1.1 (4:) Photosystem I subunit PsaD {Thermosynechococcus elongatus [TaxId: 197221]}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

SCOPe Domain Coordinates for d6trd4_:

Click to download the PDB-style file with coordinates for d6trd4_.
(The format of our PDB-style files is described here.)

Timeline for d6trd4_: