![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) ![]() |
![]() | Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins) |
![]() | Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377780] (5 PDB entries) |
![]() | Domain d6trd7_: 6trd 7: [392177] Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_ automated match to d1jb0i_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trd7_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trd7_ f.23.17.1 (7:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]} mmgsyaasflpwifipvvcwlmptvvmgllflyiegea
Timeline for d6trd7_: