Lineage for d6trd7_ (6trd 7:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026161Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 3026162Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 3026163Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)
  7. 3026166Species Thermosynechococcus elongatus [TaxId:197221] [377780] (5 PDB entries)
  8. 3026170Domain d6trd7_: 6trd 7: [392177]
    Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdj_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
    automated match to d1jb0i_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd7_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (7:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6trd7_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trd7_ f.23.17.1 (7:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOPe Domain Coordinates for d6trd7_:

Click to download the PDB-style file with coordinates for d6trd7_.
(The format of our PDB-style files is described here.)

Timeline for d6trd7_: