Lineage for d6trd8_ (6trd 8:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026184Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)
  6. 3026185Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species)
  7. 3026188Species Thermosynechococcus elongatus [TaxId:197221] [377947] (5 PDB entries)
  8. 3026192Domain d6trd8_: 6trd 8: [392089]
    Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdk_, d6trdl_, d6trdm_, d6trdx_, d6trdy_, d6trdz_
    automated match to d1jb0j_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6trd8_

PDB Entry: 6trd (more details), 3.16 Å

PDB Description: cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6
PDB Compounds: (8:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6trd8_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trd8_ f.23.18.1 (8:) Subunit IX of photosystem I reaction centre, PsaJ {Thermosynechococcus elongatus [TaxId: 197221]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl

SCOPe Domain Coordinates for d6trd8_:

Click to download the PDB-style file with coordinates for d6trd8_.
(The format of our PDB-style files is described here.)

Timeline for d6trd8_: