![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family) ![]() automatically mapped to Pfam PF07465 |
![]() | Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins) |
![]() | Protein Subunit XII of photosystem I reaction centre, PsaM [81546] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377772] (5 PDB entries) |
![]() | Domain d6trdy_: 6trd y: [392045] Other proteins in same PDB: d6trd0_, d6trd1_, d6trd2_, d6trd3_, d6trd4_, d6trd5_, d6trd6_, d6trd7_, d6trd8_, d6trd9_, d6trda_, d6trdb_, d6trdc_, d6trdd_, d6trde_, d6trdf_, d6trdi_, d6trdj_, d6trdk_, d6trdl_, d6trdx_, d6trdz_ automated match to d1jb0m_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6trd (more details), 3.16 Å
SCOPe Domain Sequences for d6trdy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trdy_ f.23.19.1 (y:) Subunit XII of photosystem I reaction centre, PsaM {Thermosynechococcus elongatus [TaxId: 197221]} maltdtqvyvalviallpavlafrlstelyk
Timeline for d6trdy_: