Lineage for d5kaff_ (5kaf f:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026808Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)
  8. 3026817Domain d5kaff_: 5kaf f: [326603]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaff_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5kaff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaff_ f.23.38.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5kaff_:

Click to download the PDB-style file with coordinates for d5kaff_.
(The format of our PDB-style files is described here.)

Timeline for d5kaff_: