Lineage for d5kaff_ (5kaf f:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227446Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2227447Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2227467Protein automated matches [191000] (4 species)
    not a true protein
  7. 2283301Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)
  8. 2283302Domain d5kaff_: 5kaf f: [326603]
    Other proteins in same PDB: d5kafl_, d5kafm1, d5kafm2, d5kafo_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaff_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5kaff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaff_ f.23.38.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5kaff_:

Click to download the PDB-style file with coordinates for d5kaff_.
(The format of our PDB-style files is described here.)

Timeline for d5kaff_:

  • d5kaff_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24