Lineage for d5kafj_ (5kaf J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026451Protein automated matches [191002] (3 species)
    not a true protein
  7. 3026452Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries)
  8. 3026455Domain d5kafj_: 5kaf J: [327748]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d4ub8j_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafj_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5kafj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafj_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5kafj_:

Click to download the PDB-style file with coordinates for d5kafj_.
(The format of our PDB-style files is described here.)

Timeline for d5kafj_: