SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kafx_ (5kaf X:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227482Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2227483Family f.23.40.1: PsbX-like [267615] (2 protein domains)
  6. 2227487Protein automated matches [267680] (2 species)
    not a true protein
  7. 2227488Species Thermosynechococcus elongatus [TaxId:197221] [311275] (6 PDB entries)
  8. 2284466Domain d5kafx_: 5kaf X: [327767]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafz_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafx_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d5kafx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d5kafx_:

Click to download the PDB-style file with coordinates for d5kafx_.
(The format of our PDB-style files is described here.)

Timeline for d5kafx_:

  • d5kafx_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30