SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kafk_ (5kaf k:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227418Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2283988Family f.23.36.0: automated matches [327289] (1 protein)
    not a true family
  6. 2283989Protein automated matches [327290] (1 species)
    not a true protein
  7. 2283990Species Thermosynechococcus elongatus [TaxId:197221] [327291] (3 PDB entries)
  8. 2284470Domain d5kafk_: 5kaf k: [327771]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafk_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kafk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafk_ f.23.36.0 (k:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5kafk_:

Click to download the PDB-style file with coordinates for d5kafk_.
(The format of our PDB-style files is described here.)

Timeline for d5kafk_:

  • d5kafk_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30