Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein automated matches [191001] (5 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries) |
Domain d5kafh_: 5kaf H: [327762] Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d2axth1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafh_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wka
Timeline for d5kafh_: