Lineage for d5kafh_ (5kaf H:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227370Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2227371Family f.23.33.1: PsbH-like [161026] (2 protein domains)
    Pfam PF00737
  6. 2227378Protein automated matches [191001] (3 species)
    not a true protein
  7. 2284460Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries)
  8. 2284461Domain d5kafh_: 5kaf H: [327762]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axth1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafh_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5kafh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafh_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5kafh_:

Click to download the PDB-style file with coordinates for d5kafh_.
(The format of our PDB-style files is described here.)

Timeline for d5kafh_:

  • d5kafh_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30