SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kafh_ (5kaf H:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227370Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2227371Family f.23.33.1: PsbH-like [161026] (2 protein domains)
    Pfam PF00737
  6. 2227378Protein automated matches [191001] (3 species)
    not a true protein
  7. 2284460Species Thermosynechococcus elongatus [TaxId:197221] [327761] (2 PDB entries)
  8. 2284461Domain d5kafh_: 5kaf H: [327762]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axth1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafh_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5kafh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafh_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5kafh_:

Click to download the PDB-style file with coordinates for d5kafh_.
(The format of our PDB-style files is described here.)

Timeline for d5kafh_:

  • d5kafh_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30