SCOPe 2.08: Domain d5kafm1: 5kaf M:2-33

Lineage for d5kafm1 (5kaf M:2-33)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
   Uniprot Q8DHA7 1-36

8. Domain d5kafm1: 5kaf M:2-33 [326604]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
   automated match to d2axtm1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafm1

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5kafm1:

Sequence; same for both SEQRES and ATOM records:

>d5kafm1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
evnqlgliatalfvlvpsvfliilyvqtesqq

Timeline for d5kafm1:

• d5kafm1 first appeared in SCOPe 2.06
  
• d5kafm1 appears in SCOPe 2.07