![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
![]() | Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
![]() | Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries) Uniprot Q8DHA7 1-36 |
![]() | Domain d5kafm1: 5kaf M:2-33 [326604] Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d2axtm1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafm1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]} evnqlgliatalfvlvpsvfliilyvqtesqq
Timeline for d5kafm1: