Lineage for d5kafm1 (5kaf M:2-33)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227401Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2227402Family f.23.35.1: PsbM-like [161034] (2 protein domains)
    Pfam PF05151
  6. 2227403Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2227404Species Thermosynechococcus elongatus [TaxId:146786] [161036] (6 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 2283303Domain d5kafm1: 5kaf M:2-33 [326604]
    Other proteins in same PDB: d5kaff_, d5kafl_, d5kafm2, d5kafo_
    automated match to d2axtm1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafm1

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5kafm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafm1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
evnqlgliatalfvlvpsvfliilyvqtesqq

SCOPe Domain Coordinates for d5kafm1:

Click to download the PDB-style file with coordinates for d5kafm1.
(The format of our PDB-style files is described here.)

Timeline for d5kafm1:

  • d5kafm1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-25