SCOPe 2.08: Domain d5kafi1: 5kaf I:2-36

Lineage for d5kafi1 (5kaf I:2-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family)
   automatically mapped to Pfam PF02532

5. Family f.23.37.1: PsbI-like [161042] (1 protein)
   Pfam PF02532

6. Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)

8. Domain d5kafi1: 5kaf I:2-36 [327780]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
   automated match to d4ub8i_
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafi1

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5kafi1:

Sequence; same for both SEQRES and ATOM records:

>d5kafi1 f.23.37.1 (I:2-36) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
etlkitvyivvtffvllfvfgflsgdparnpkrkd

Timeline for d5kafi1:

• d5kafi1 first appeared in SCOPe 2.06
  
• d5kafi1 appears in SCOPe 2.07