Lineage for d5kafi1 (5kaf I:2-36)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227432Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2227433Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2227434Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2284443Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)
  8. 2284479Domain d5kafi1: 5kaf I:2-36 [327780]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d4ub8i_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafi1

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5kafi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafi1 f.23.37.1 (I:2-36) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
etlkitvyivvtffvllfvfgflsgdparnpkrkd

SCOPe Domain Coordinates for d5kafi1:

Click to download the PDB-style file with coordinates for d5kafi1.
(The format of our PDB-style files is described here.)

Timeline for d5kafi1:

  • d5kafi1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-30