Lineage for d5kafo_ (5kaf o:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021998Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 3022031Protein automated matches [191004] (2 species)
    not a true protein
  7. 3022032Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 3022037Domain d5kafo_: 5kaf o: [326606]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafo_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (o:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5kafo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafo_ f.4.1.4 (o:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

SCOPe Domain Coordinates for d5kafo_:

Click to download the PDB-style file with coordinates for d5kafo_.
(The format of our PDB-style files is described here.)

Timeline for d5kafo_: